A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata
peer-reviewed · Marine Drugs · 2013
| Date | 2013-05-24 |
| Type | peer-reviewed |
| Venue | Marine Drugs |
| Publisher | MDPI AG |
| Contribution | downstream-application |
| DOI | 10.3390/md11061800 |
| Citations (OpenAlex) | 37 |
Abstract
A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNH DGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRK NNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/ TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC₅₀ values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively.
Methods and tools
- Arca subcrenata antiproliferative peptide H3: Isolation of an antitumor and antioxidant polypeptide from the ark clam Arca subcrenata, with partial sequences read by MALDI-TOF/TOF de novo sequencing.